PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010933718.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 335aa    MW: 38528.1 Da    PI: 6.7947
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010933718.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM182.41.1e-5671361129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                     +ppGfrFhPtdeelv++yL+kk+++++++l +vik+vd+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nrat++g+Wkatg+dk++
  XP_010933718.1   7 VPPGFRFHPTDEELVDYYLRKKIASRRIDL-DVIKDVDLYKIEPWDLQEkcKIGTeEQNEWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKPI 100
                     69****************************.9***************952444443555************************************ PP

             NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     +s k++l+g++ktLvfykgrap+g+k+dW+mheyrle
  XP_010933718.1 101 YS-KNNLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                     **.899*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.14E-624156IPR003441NAC domain
PROSITE profilePS5100560.8097156IPR003441NAC domain
PfamPF023658.6E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 335 aa     Download sequence    Send to blast
MTTFSNVPPG FRFHPTDEEL VDYYLRKKIA SRRIDLDVIK DVDLYKIEPW DLQEKCKIGT  60
EEQNEWYFFS HKDKKYPTGT RTNRATAAGF WKATGRDKPI YSKNNLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTPQEEGWVV CRVFKKKVTA IRGASEHESP CWYDEQSSFM  180
PDLDSPKQIA PHPDMAYHHH LYSCKPEQDL PHLMPNDSFL QLPQLESPKL PNNVNHGCAL  240
QSSTIRPEEP IQHGHQLQII SLYNPSGGTD QSVEQVTDWR VLDKFVASQL SHDDHVSKEP  300
NYSNSAQGFH VSDKQEATIA YASTSTSSGQ INLWK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A1e-53615714169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010933718.10.0PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-136NAC7_ARATH; NAC domain-containing protein 7
TrEMBLA0A0G2UF560.0A0A0G2UF56_MUSPR; Vascular related NAC-domain protein 3
STRINGGSMUA_Achr11P17510_0010.0(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23703892
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-123NAC 007